LARS2 Antibody

Images

 
Immunohistochemistry-Paraffin: LARS2 Antibody [NBP1-83059] - Staining of human colon shows cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LARS2 Protein (NBP1-83059PEP)
Publications
Read Publication using NBP1-83059.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%). Reactivity reported in scientific literature (PMID: 24413190)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LARS2 Antibody

  • EC 6.1.1
  • EC 6.1.1.4
  • KIAA0028leucine tRNA ligase 2, mitocondrial
  • leucine translase
  • Leucine--tRNA ligase
  • leucyl-tRNA synthetase 2, mitochondrial
  • LEURS
  • MGC26121
  • probable leucyl-tRNA synthetase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19702
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83059
Species: Hu
Applications: IHC, IHC-P

Publications for LARS2 Antibody (NBP1-83059)(1)

Reviews for LARS2 Antibody (NBP1-83059) (0)

There are no reviews for LARS2 Antibody (NBP1-83059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LARS2 Antibody (NBP1-83059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LARS2 Products

Bioinformatics Tool for LARS2 Antibody (NBP1-83059)

Discover related pathways, diseases and genes to LARS2 Antibody (NBP1-83059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LARS2 Antibody (NBP1-83059)

Discover more about diseases related to LARS2 Antibody (NBP1-83059).
 

Pathways for LARS2 Antibody (NBP1-83059)

View related products by pathway.

PTMs for LARS2 Antibody (NBP1-83059)

Learn more about PTMs related to LARS2 Antibody (NBP1-83059).

Blogs on LARS2

There are no specific blogs for LARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LARS2