LARS2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LARS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%). Reactivity reported in scientific literature (PMID: 24413190)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for LARS2 Antibody - BSA Free
Background
LARS2, also known as Probable leucine--tRNA ligase, mitochondrial, is a 903 amino acid protein that is 102 kDa, catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. Disease research is currently being performed with relation to LARS2 and rocky mountain spotted fever, specific phobia, spotted fever, phobia, lactic acidosis, mitochondrial encephalomyopathy, encephalomyopathy, neisseria meningitides, bipolar disorder, nasopharyngitis, pneumonia, schizophrenia, tuberculosis, malaria, and carcinoma. This protein has been shown to have interactions with 20 proteins including ICT1, SRPR, PMM2, NMNAT1, and NAF1 in tRNA aminoacylation, gene expression, mitochondrial tRNA aminoacylation, valine, leucine and isoleucine biosynthesis, and aminoacyl-tRNA biosynthesis pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ze
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for LARS2 Antibody (NBP1-83059)(1)
Showing Publication 1 -
1 of 1.
Reviews for LARS2 Antibody (NBP1-83059) (0)
There are no reviews for LARS2 Antibody (NBP1-83059).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for LARS2 Antibody (NBP1-83059) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LARS2 Products
Blogs on LARS2