LARP1 Antibody

Immunohistochemistry-Paraffin: LARP1 Antibody [NBP2-49004] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LARP1 Antibody [NBP2-49004] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: LARP1 Antibody [NBP2-49004] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: LARP1 Antibody [NBP2-49004] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry: LARP1 Antibody [NBP2-49004] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Product Discontinued

LARP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LARP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LARP1 Antibody

• KIAA0731LARPMGC19556
• La ribonucleoprotein domain family member 1
• La ribonucleoprotein domain family, member 1
• la-related protein 1

Background

LARP1 (la-related protein 1) is part of a family of proteins that bears a La motif. The La motif was first identified in the La protein which was isolated as an autoreactive antigen in patients afflicted with systemic lupus erythematosus. Like the La protein, LARP proteins appear to be RNA-binding proteins, and are proposed to play a role in translation elongation and termination. Alternative names for LARP1 include la ribonucleoprotein domain family member 1, LARP, and KIAA0731.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LARP1