Lactate Dehydrogenase C Antibody

Images

 
Western Blot: Lactate Dehydrogenase C Antibody [H00003948-B01P] - Analysis of LDHC expression in transfected 293T cell line by LDHC polyclonal antibody. Lane 1: LDHC transfected lysate(36.52 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lactate Dehydrogenase C Antibody Summary

Immunogen
LDHC (NP_002292.1, 1 a.a. - 332 a.a.) full-length human protein. MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Specificity
LDHC - lactate dehydrogenase C,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LDHC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lactate Dehydrogenase C Antibody

  • Cancer/testis antigen 32
  • CT32EC 1.1.1.27
  • EC 1.1.1
  • lactate dehydrogenase C
  • lactate dehydrogenase C4
  • LDH testis subunit
  • LDH3MGC111073
  • LDH-C
  • LDHX
  • LDH-X
  • L-lactate dehydrogenase C chain

Background

Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Lactate Dehydrogenase C Antibody (H00003948-B01P) (0)

There are no publications for Lactate Dehydrogenase C Antibody (H00003948-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactate Dehydrogenase C Antibody (H00003948-B01P) (0)

There are no reviews for Lactate Dehydrogenase C Antibody (H00003948-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lactate Dehydrogenase C Antibody (H00003948-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactate Dehydrogenase C Products

Bioinformatics Tool for Lactate Dehydrogenase C Antibody (H00003948-B01P)

Discover related pathways, diseases and genes to Lactate Dehydrogenase C Antibody (H00003948-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase C Antibody (H00003948-B01P)

Discover more about diseases related to Lactate Dehydrogenase C Antibody (H00003948-B01P).
 

Pathways for Lactate Dehydrogenase C Antibody (H00003948-B01P)

View related products by pathway.

PTMs for Lactate Dehydrogenase C Antibody (H00003948-B01P)

Learn more about PTMs related to Lactate Dehydrogenase C Antibody (H00003948-B01P).

Blogs on Lactate Dehydrogenase C

There are no specific blogs for Lactate Dehydrogenase C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactate Dehydrogenase C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHC
Entrez
Uniprot