KvBeta2 Antibody - BSA Free

Western Blot: KvBeta2 Antibody [NBP1-80097] - Host: Mouse. Target Name: KCNAB2. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml

Western Blot: KvBeta2 Antibody [NBP1-80097] - HepG2 cell lysate, concentration 1.25ug/ml.

Western Blot: KvBeta2 Antibody [NBP1-80097] - Antibody Titration: 1 ug/ml Human HepG2.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

KvBeta2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNAB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for KvBeta2 Antibody - BSA Free

• HKvbeta2
• HKvbeta2.1
• HKvbeta2.2
• K(+) channel subunit beta-2
• K+ channel beta-2 subunit
• KCNA2BAKR6A5
• KCNK2
• KV-BETA-2
• MGC117289
• potassium channel shaker chain beta 2
• potassium voltage-gated channel, shaker-related subfamily, beta member 2
• voltage-gated potassium channel subunit beta-2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNAB2
• Uniprot:
  • NP_742128(Human)