KvBeta2 Antibody

Images

 
Western Blot: KvBeta2 Antibody [NBP1-80097] - Antibody Titration: 1 ug/ml Human HepG2.
Western Blot: KvBeta2 Antibody [NBP1-80097] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KvBeta2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNAB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KCNAB2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KvBeta2 Antibody

  • HKvbeta2
  • HKvbeta2.1
  • HKvbeta2.2
  • K(+) channel subunit beta-2
  • K+ channel beta-2 subunit
  • KCNA2BAKR6A5
  • KCNK2
  • KV-BETA-2
  • MGC117289
  • potassium channel shaker chain beta 2
  • potassium voltage-gated channel, shaker-related subfamily, beta member 2
  • voltage-gated potassium channel subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-81571
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP1-69621
Species: Hu
Applications: WB
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67704
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-34063
Species: Hu
Applications: IHC, IHC-P
NBP2-04360
Species: Hu
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-42788
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, IP
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82864
Species: Hu
Applications: IHC, IHC-P
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80084
Species: Hu
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF7548
Species: Hu
Applications: IHC

Publications for KvBeta2 Antibody (NBP1-80097) (0)

There are no publications for KvBeta2 Antibody (NBP1-80097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KvBeta2 Antibody (NBP1-80097) (0)

There are no reviews for KvBeta2 Antibody (NBP1-80097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KvBeta2 Antibody (NBP1-80097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KvBeta2 Antibody (NBP1-80097)

Discover related pathways, diseases and genes to KvBeta2 Antibody (NBP1-80097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KvBeta2 Antibody (NBP1-80097)

Discover more about diseases related to KvBeta2 Antibody (NBP1-80097).
 

Pathways for KvBeta2 Antibody (NBP1-80097)

View related products by pathway.

PTMs for KvBeta2 Antibody (NBP1-80097)

Learn more about PTMs related to KvBeta2 Antibody (NBP1-80097).
 

Research Areas for KvBeta2 Antibody (NBP1-80097)

Find related products by research area.

Blogs on KvBeta2

There are no specific blogs for KvBeta2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KvBeta2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNAB2
Uniprot