Kv9.1 Antibody

Images

 
Western Blot: Kv9.1 Antibody [NBP1-80063] - Kv9.1 Antibody Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv9.1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KCNS1. Peptide sequence: LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KCNS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv9.1 Antibody

  • potassium voltage-gated channel subfamily S member 1
  • potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-14145
Species: Hu
Applications: IHC, IHC-P
NBP1-81334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81605
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
PPS015
Species: Rt, Xp
Applications: WB, IHC
H00006192-P01
Species: Hu
NBP2-17028
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-05160
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12165
Species: Hu
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-59328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-82860
Species: Hu
Applications: IHC, IHC-P
NBP1-80063
Species: Hu
Applications: WB

Publications for Kv9.1 Antibody (NBP1-80063) (0)

There are no publications for Kv9.1 Antibody (NBP1-80063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv9.1 Antibody (NBP1-80063) (0)

There are no reviews for Kv9.1 Antibody (NBP1-80063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv9.1 Antibody (NBP1-80063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv9.1 Products

Kv9.1 NBP1-80063

Bioinformatics Tool for Kv9.1 Antibody (NBP1-80063)

Discover related pathways, diseases and genes to Kv9.1 Antibody (NBP1-80063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv9.1 Antibody (NBP1-80063)

Discover more about diseases related to Kv9.1 Antibody (NBP1-80063).
 

Pathways for Kv9.1 Antibody (NBP1-80063)

View related products by pathway.

Blogs on Kv9.1

There are no specific blogs for Kv9.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv9.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNS1
Uniprot