Kv8.2 Recombinant Protein Antigen

Images

 
There are currently no images for Kv8.2 Protein (NBP1-82860PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv8.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNV2.

Source: E.coli

Amino Acid Sequence: WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNV2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82860.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Kv8.2 Recombinant Protein Antigen

  • KV11.1
  • Kv8.2
  • MGC120515
  • potassium channel, subfamily V, member 2
  • potassium voltage-gated channel subfamily V member 2
  • RCD3B
  • voltage-gated potassium channel Kv8.2
  • Voltage-gated potassium channel subunit Kv8.2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamilymembers. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channelsubunits. This protein is strongly expressed in pancreas and has a weaker expression in several other tissues.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-06083
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NBP2-84125
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
640-A3
Species: Mu
Applications: Bind
H00170850-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-12898
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10293
Species: Hu
Applications: WB

Publications for Kv8.2 Protein (NBP1-82860PEP) (0)

There are no publications for Kv8.2 Protein (NBP1-82860PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv8.2 Protein (NBP1-82860PEP) (0)

There are no reviews for Kv8.2 Protein (NBP1-82860PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv8.2 Protein (NBP1-82860PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv8.2 Products

Array NBP1-82860PEP

Bioinformatics Tool for Kv8.2 Protein (NBP1-82860PEP)

Discover related pathways, diseases and genes to Kv8.2 Protein (NBP1-82860PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv8.2 Protein (NBP1-82860PEP)

Discover more about diseases related to Kv8.2 Protein (NBP1-82860PEP).
 

Pathways for Kv8.2 Protein (NBP1-82860PEP)

View related products by pathway.

Research Areas for Kv8.2 Protein (NBP1-82860PEP)

Find related products by research area.

Blogs on Kv8.2

There are no specific blogs for Kv8.2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv8.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNV2