Kv8.2 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNV2. Source: E.coli
Amino Acid Sequence: WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
KCNV2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP1-82860.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for Kv8.2 Recombinant Protein Antigen
Background
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamilymembers. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channelsubunits. This protein is strongly expressed in pancreas and has a weaker expression in several other tissues.(provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Kv8.2 Protein (NBP1-82860PEP) (0)
There are no publications for Kv8.2 Protein (NBP1-82860PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kv8.2 Protein (NBP1-82860PEP) (0)
There are no reviews for Kv8.2 Protein (NBP1-82860PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Kv8.2 Protein (NBP1-82860PEP) (0)
Additional Kv8.2 Products
Bioinformatics Tool for Kv8.2 Protein (NBP1-82860PEP)
Discover related pathways, diseases and genes to Kv8.2 Protein (NBP1-82860PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Kv8.2 Protein (NBP1-82860PEP)
Discover more about diseases related to Kv8.2 Protein (NBP1-82860PEP).
| | Pathways for Kv8.2 Protein (NBP1-82860PEP)
View related products by pathway.
|
Research Areas for Kv8.2 Protein (NBP1-82860PEP)
Find related products by research area.
|
Blogs on Kv8.2