Kv8.1 Antibody - BSA Free

Staining of human cell line HeLa shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv8.1 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Kv8.1 using the following amino acid sequence: LCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEK
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNV1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kv8.1 Antibody - BSA Free

• HNKA
• KCNB3
• KV2.3
• KV8.1
• Neuronal potassium channel alpha subunit HNKA
• potassium channel Kv8.1
• potassium channel, subfamily V, member 1
• potassium voltage-gated channel subfamily V member 1
• Voltage-gated potassium channel subunit Kv8.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNV1