Kv8.1 Antibody - BSA Free

Western Blot: Kv8.1 Antibody [NBP2-84129] - Host: Rabbit. Target Name: CHAD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Western Blot: Kv8.1 Antibody [NBP2-84129] - WB Suggested Anti-KCNV1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

Western Blot: Kv8.1 Antibody [NBP2-84129] - Host: Rabbit. Target Name: KCNV1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kv8.1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv8.1 Antibody - BSA Free (NBP2-84129) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Kv8.1. Peptide sequence: ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNV1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kv8.1 Antibody - BSA Free

• HNKA
• KCNB3
• KV2.3
• KV8.1
• Neuronal potassium channel alpha subunit HNKA
• potassium channel Kv8.1
• potassium channel, subfamily V, member 1
• potassium voltage-gated channel subfamily V member 1
• Voltage-gated potassium channel subunit Kv8.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNV1