Kv7.4 Antibody - BSA Free

Western Blot: Kv7.4 Antibody [NBP2-82272] - Lanes: 100 ug CHO cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit HRP. Secondary Antibody Dilution: 1:25000. Gene Name: KCNQ4. Submitted by: Anonymous.

Western Blot: Kv7.4 Antibody [NBP2-82272] - WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/ml. Positive Control: HT1080 cell lysate

• Reactivity: Hu, Ha
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kv7.4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Kv7.4. Peptide sequence: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNQ4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kv7.4 Antibody - BSA Free

• DFNA2
• DFNA2A
• KCNQ4
• KQT-like 4
• Kv7.4
• potassium channel KQT-like 4
• Potassium channel subunit alpha KvLQT4
• potassium voltage-gated channel subfamily KQT member 4
• potassium voltage-gated channel, KQT-like subfamily, member 4
• Voltage-gated potassium channel subunit Kv7.4

Background

KCNQ4 is encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNQ4