Kv4.1 Antibody

Images

 
Western Blot: Kv4.1 Antibody [NBP1-74103] - Mouse Spleen Lysate 1ug/ml Gel Concentration: 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv4.1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Kcnd1. Immunizing peptide sequence MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCND1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Kcnd1 and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv4.1 Antibody

  • Kv4.1
  • potassium voltage-gated channel subfamily D member 1
  • potassium voltage-gated channel, Shal-related subfamily, member 1
  • shal-type potassium channel
  • voltage-gated potassium channel Kv4.1
  • Voltage-gated potassium channel subunit Kv4.1

Background

Kcnd1 is a pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. It may contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are modulated by subunit assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
PPS015
Species: Rt, Xp
Applications: WB, IHC
H00003736-B01P
Species: Hu
Applications: WB
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-47481
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-89717
Species: Hu
Applications: IHC, IHC-P
NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
NBP1-74103
Species: Mu
Applications: WB

Publications for Kv4.1 Antibody (NBP1-74103) (0)

There are no publications for Kv4.1 Antibody (NBP1-74103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv4.1 Antibody (NBP1-74103) (0)

There are no reviews for Kv4.1 Antibody (NBP1-74103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv4.1 Antibody (NBP1-74103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv4.1 Products

Bioinformatics Tool for Kv4.1 Antibody (NBP1-74103)

Discover related pathways, diseases and genes to Kv4.1 Antibody (NBP1-74103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv4.1 Antibody (NBP1-74103)

Discover more about diseases related to Kv4.1 Antibody (NBP1-74103).
 

Pathways for Kv4.1 Antibody (NBP1-74103)

View related products by pathway.

Blogs on Kv4.1

There are no specific blogs for Kv4.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv4.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCND1
Uniprot