Kv11.2 Recombinant Protein Antigen

Images

 
There are currently no images for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv11.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv11.2

Source: E. coli

Amino Acid Sequence: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNH6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17875.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv11.2 Recombinant Protein Antigen

  • eag related protein 2
  • eag-related gene member 2
  • Eag-related protein 2
  • ERG2
  • ERG-2
  • ether-a-go-go related gene potassium channel 2
  • Ether-a-go-go-related gene potassium channel 2
  • Ether-a-go-go-related protein 2
  • hERG2
  • hERG-2
  • KCNH6
  • Kv11.2
  • potassium voltage-gated channel subfamily H member 6
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Voltage-gated potassium channel subunit Kv11.2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-17029
Species: Hu, Mu, Rt
Applications: WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-55973
Species: Hu
Applications: ICC/IF, WB
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38146
Species: Hu
Applications: IHC,  IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-804
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
NBP1-84730
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
NBP1-84935
Species: Hu
Applications: IHC,  IHC-P
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
AF640
Species: Mu
Applications: IHC, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP) (0)

There are no publications for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP) (0)

There are no reviews for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv11.2 Products

Research Areas for Kv11.2 Recombinant Protein Antigen (NBP3-17875PEP)

Find related products by research area.

Blogs on Kv11.2

There are no specific blogs for Kv11.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv11.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNH6