KRTAP1-5 Antibody

Images

 
Western Blot: KRTAP1-5 Antibody [NBP1-79847] - Human Fetal Brain Lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRTAP1-5 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human KRTAP1-5The immunogen for this antibody is KRTAP1-5. Peptide sequence TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRTAP1-5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KRTAP1-5 and was validated on Western blot.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KRTAP1-5 Antibody

  • KAP1.5High sulfur keratin-associated protein 1.5
  • keratin associated protein 1.5
  • keratin associated protein 1-5
  • Keratin-associated protein 1.5
  • keratin-associated protein 1-5
  • KRTAP1.5
  • KRTAP-15
  • MGC126604

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12402
Species: Hu
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7559-ST
Species: Hu
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for KRTAP1-5 Antibody (NBP1-79847) (0)

There are no publications for KRTAP1-5 Antibody (NBP1-79847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRTAP1-5 Antibody (NBP1-79847) (0)

There are no reviews for KRTAP1-5 Antibody (NBP1-79847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRTAP1-5 Antibody (NBP1-79847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRTAP1-5 Products

Bioinformatics Tool for KRTAP1-5 Antibody (NBP1-79847)

Discover related pathways, diseases and genes to KRTAP1-5 Antibody (NBP1-79847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for KRTAP1-5 Antibody (NBP1-79847)

View related products by pathway.

Blogs on KRTAP1-5

There are no specific blogs for KRTAP1-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRTAP1-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRTAP1-5
Uniprot