KRT85 Antibody

Images

 
Western Blot: KRT85 Antibody [NBP2-59670] - Host: Rabbit. Target Name: KRT85. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: KRT85 Antibody [NBP2-59670]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT85 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT85. 507 amino acids: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT. Peptide sequence: DVASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLT The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT85
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse: 93%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
1x PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRT85 Antibody

  • Keratin 85

Background

The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
NBL1-12400
Species: Hu
Applications: WB
H00003886-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003887-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00003889-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB110-56916
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-61736
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00003882-B01P
Species: Hu
Applications: WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA

Publications for KRT85 Antibody (NBP2-59670) (0)

There are no publications for KRT85 Antibody (NBP2-59670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT85 Antibody (NBP2-59670) (0)

There are no reviews for KRT85 Antibody (NBP2-59670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRT85 Antibody (NBP2-59670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT85 Products

Array NBP2-59670

Bioinformatics Tool for KRT85 Antibody (NBP2-59670)

Discover related pathways, diseases and genes to KRT85 Antibody (NBP2-59670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KRT85 Antibody (NBP2-59670)

Discover more about diseases related to KRT85 Antibody (NBP2-59670).
 

Pathways for KRT85 Antibody (NBP2-59670)

View related products by pathway.

Blogs on KRT85

There are no specific blogs for KRT85, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT85 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT85