KOR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KOR Antibody [NBP2-68859] - Staining of human cell line AF22 shows localization to plasma membrane & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KOR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OPRK1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  KOR Recombinant Protein Antigen (NBP2-68859PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for KOR Antibody - BSA Free

• kappa opioid receptor
• kappa-type opioid receptor
• KOR
• K-OR-1
• KOR-1
• Opiate receptor, kappa-1
• opioid receptor, kappa 1
• OPRK
• OPRK1
• Oprk2
• R21

Background

Kappa Opioid Receptor inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for dynorphins. May play a role in arousal and regulation of autonomic and neuroendocrine functions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OPRK1