KLHL31 Antibody

Images

 
Western Blot: KLHL31 Antibody [NBP1-70594] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: KLHL31 Antibody [NBP1-70594] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL31 Antibody Summary

Immunogen
Synthetic peptides corresponding to KLHL31(kelch-like 31 (Drosophila)) The peptide sequence was selected from the C terminal of KLHL31. Peptide sequence TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHL31 Antibody

  • bA345L23.2
  • BKLHD6
  • BTB and kelch domain-containing protein 6
  • KBTBD1
  • kelch repeat and BTB (POZ) domain containing 1
  • kelch repeat and BTB domain-containing protein 1
  • kelch-like 31 (Drosophila)
  • kelch-like protein 31
  • kelch-like protein KLHL
  • KLHL

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1620
Species: Mu
Applications: WB, IHC
AF4109
Species: Hu
Applications: WB, IHC
AF1914
Species: Hu
Applications: WB, Flow, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-77359
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF4109
Species: Hu
Applications: WB, IHC
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for KLHL31 Antibody (NBP1-70594) (0)

There are no publications for KLHL31 Antibody (NBP1-70594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL31 Antibody (NBP1-70594) (0)

There are no reviews for KLHL31 Antibody (NBP1-70594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL31 Antibody (NBP1-70594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL31 Products

KLHL31 NBP1-70594

Bioinformatics Tool for KLHL31 Antibody (NBP1-70594)

Discover related pathways, diseases and genes to KLHL31 Antibody (NBP1-70594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL31 Antibody (NBP1-70594)

Discover more about diseases related to KLHL31 Antibody (NBP1-70594).
 

Pathways for KLHL31 Antibody (NBP1-70594)

View related products by pathway.

PTMs for KLHL31 Antibody (NBP1-70594)

Learn more about PTMs related to KLHL31 Antibody (NBP1-70594).

Blogs on KLHL31

There are no specific blogs for KLHL31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL31