KLHL13 Antibody

Images

 
Western Blot: KLHL13 Antibody [NBP1-80047] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: KLHL13 Antibody [NBP1-80047] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL13 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KLHL13. Peptide sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against KLHL13 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHL13 Antibody

  • BTB and kelch domain containing 2
  • BTB and kelch domain-containing protein 2
  • kelch-like 13 (Drosophila)
  • kelch-like protein 13
  • KIAA1309
  • MGC74791

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56152
Species: Hu
Applications: ICC/IF
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-17081
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP2-30654
Species: Hu
Applications: IHC, IHC-P
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for KLHL13 Antibody (NBP1-80047) (0)

There are no publications for KLHL13 Antibody (NBP1-80047).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL13 Antibody (NBP1-80047) (0)

There are no reviews for KLHL13 Antibody (NBP1-80047). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL13 Antibody (NBP1-80047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL13 Products

Bioinformatics Tool for KLHL13 Antibody (NBP1-80047)

Discover related pathways, diseases and genes to KLHL13 Antibody (NBP1-80047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL13 Antibody (NBP1-80047)

Discover more about diseases related to KLHL13 Antibody (NBP1-80047).
 

Pathways for KLHL13 Antibody (NBP1-80047)

View related products by pathway.

PTMs for KLHL13 Antibody (NBP1-80047)

Learn more about PTMs related to KLHL13 Antibody (NBP1-80047).

Blogs on KLHL13

There are no specific blogs for KLHL13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL13
Uniprot