KLHL11 Antibody

Images

 
Western Blot: KLHL11 Antibody [NBP1-83846] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: KLHL11 Antibody [NBP1-83846] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VANNEVCVKLVADAVERHALRAENIQSGTCQHPTSHVSLLPRYGQNMDVIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHL11 Protein (NBP1-83846PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHL11 Antibody

  • FLJ10572
  • kelch-like 11 (Drosophila)
  • kelch-like protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
1407-PI
Species: Hu
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for KLHL11 Antibody (NBP1-83846) (0)

There are no publications for KLHL11 Antibody (NBP1-83846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL11 Antibody (NBP1-83846) (0)

There are no reviews for KLHL11 Antibody (NBP1-83846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL11 Antibody (NBP1-83846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHL11 Products

Bioinformatics Tool for KLHL11 Antibody (NBP1-83846)

Discover related pathways, diseases and genes to KLHL11 Antibody (NBP1-83846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL11 Antibody (NBP1-83846)

Discover more about diseases related to KLHL11 Antibody (NBP1-83846).
 

Pathways for KLHL11 Antibody (NBP1-83846)

View related products by pathway.

Blogs on KLHL11

There are no specific blogs for KLHL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL11