KLC1 Recombinant Protein Antigen

Images

 
There are currently no images for KLC1 Protein (NBP2-33649PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KLC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLC1.

Source: E. coli

Amino Acid Sequence: EEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33649.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KLC1 Recombinant Protein Antigen

  • hKLC1B
  • hKLC1G
  • hKLC1J
  • hKLC1S
  • kinesin 2 60/70kDa
  • kinesin 2
  • kinesin light chain 1
  • KLC 1
  • KLChKLC1N
  • KNS2AhKLC1P
  • KNS2hKLC1R
  • medulloblastoma antigen MU-MB-2.50
  • MGC15245

Background

Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
NBP2-38794
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF5346
Species: Hu
Applications: WB
NBP1-88995
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83722
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF4366
Species: Hu, Mu, Rt
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-76816
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
267-N3
Species: Hu
Applications: BA
NBP3-46613
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP1-87429
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for KLC1 Protein (NBP2-33649PEP) (0)

There are no publications for KLC1 Protein (NBP2-33649PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLC1 Protein (NBP2-33649PEP) (0)

There are no reviews for KLC1 Protein (NBP2-33649PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KLC1 Protein (NBP2-33649PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLC1 Products

Research Areas for KLC1 Protein (NBP2-33649PEP)

Find related products by research area.

Blogs on KLC1

There are no specific blogs for KLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KLC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLC1