KiSS1R/GPR54 Antibody [Alexa Fluor® 647]

Product Discontinued

KiSS1R/GPR54 Antibody [Alexa Fluor® 647] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KiSS1R/GPR54 (NP_115940.2).
  
  Sequence:
  SYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KISS1R
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for KiSS1R/GPR54 Antibody [Alexa Fluor® 647]

• AXOR12
• AXOR12hypogonadotropin-1
• G protein-coupled receptor 54
• GPR54
• GPR54kiSS-1R
• G-protein coupled receptor 54
• G-protein coupled receptor OT7T175
• HOT7T175
• Hypogonadotropin-1
• KISS1 receptor
• kiSS-1 receptor
• KiSS1R
• KiSS-1R
• Kisspeptins receptor
• Metastin Receptor
• OT7T175

Background

GPR54 is a Metastin Receptor. Metastin, also known as KiSS-1, is a metastasis suppressor gene. Mutations in GPR54 have been shown to cause autosomal recessive idiopathic hypogonadotropic hypogonadism in humans and mice, suggesting that GPR54 is a key regulator for the onset of puberty (Seminara et al. 2003). GPR54 has been reported in various human brain regions, placenta, pancreas, and spinal cord, and at lower levels in spleen, peripheral blood leukocytes, testis, lymph node, thymus, small intestine, stomach, lung, and kidney. The receptor is also abundant in tumor tissues. In rat, GPR54 is expressed in liver, intestine, and in the pons, midbrain, thalamus, hypothalamus, hippocampus, amygdala, cortex (including frontal), and striatum. ESTs have been isolated from normal placenta and kidney cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KISS1R