![Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09424] - Western blot analysis of KIR3DS1/CD158e2 in Human Testicular Tumor lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/KIR3DS1-CD158e2-Antibody-Western-Blot-NBP3-09424-img0001.jpg "Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09424] - Western blot analysis of KIR3DS1/CD158e2 in Human Testicular Tumor lysates. Antibody dilution at 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KIR3DS1/CD158e2 (NP_001077008). Peptide sequence GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIR3DS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry KIR2DS5/CD158g Antibody (1165A) [Unconjugated]](https://images.novusbio.com/images2/KIR2DS5_MAB8920_Flow_Cytometry_22086.jpg)
![Flow Cytometry KIR2DS5/CD158g Antibody (1165A) [Unconjugated]](https://images.novusbio.com/images2/KIR2DS5_MAB8920_Flow_Cytometry_18596.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIR3DS1 |
![KIR3DL1 Antibody (DX9) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "KIR3DL1 Antibody (DX9) [Unconjugated]")
![Flow Cytometry KIR2DS1/CD158h Antibody (1127B) [Unconjugated]](https://images.novusbio.com/images2/KIR2DS1_MAB8887_Flow_Cytometry_18797.jpg)
![Flow Cytometry KIR2DL1/KIR2DS5 Antibody (143211) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL1_KIR2DS5_MAB1844_Flow_Cytometry_23624.jpg)
![Agonist Activity KIR2DL4/CD158d Antibody (181703) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL4_MAB2238_Functional_Assay_2107.jpg)
![Flow Cytometry KIR2DL4/CD158d Antibody (181703) [Unconjugated]](https://images.novusbio.com/images2/mab2238_human-kir2dl4-cd158d-mab-clone-181703-flow-cytometry-142021125517.jpg)
![Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL3_MAB2014_Flow_Cytometry_23697.jpg)
![Flow Cytometry KIR3DL3/CD158z Antibody (1136B) [Unconjugated]](https://images.novusbio.com/images2/KIR3DL3_MAB8919_Flow_Cytometry_18595.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
