KIR3DS1/CD158e2 Antibody

Images

 
Western Blot: KIR3DS1/CD158e2 Antibody [NBP3-09219] - Western blot analysis of KIR3DS1/CD158e2 in Lung Tumor lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIR3DS1/CD158e2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIR3DS1/CD158e2 (NP_001269100.1). Peptide sequence IMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYG
Clonality
Polyclonal
Host
Rabbit
Gene
KIR3DS1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for KIR3DS1/CD158e2 Antibody

  • CD158e2
  • KIR3DS1
  • KIR-G1
  • nkat10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB8887
Species: Hu
Applications: Flow
MAB8920
Species: Hu
Applications: Flow
NBL1-12303
Species: Hu
Applications: WB
6634-KR
Species: Hu
Applications: BA
MAB1844
Species: Hu
Applications: CyTOF-reported, Flow
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
NBP2-50419
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
3015-KR
Species: Hu
Applications: BA
MAB1847
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB2878
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-15005
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-08750
Species: Hu
Applications: WB
MAB8919
Species: Hu
Applications: Flow
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for KIR3DS1/CD158e2 Antibody (NBP3-09219) (0)

There are no publications for KIR3DS1/CD158e2 Antibody (NBP3-09219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIR3DS1/CD158e2 Antibody (NBP3-09219) (0)

There are no reviews for KIR3DS1/CD158e2 Antibody (NBP3-09219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIR3DS1/CD158e2 Antibody (NBP3-09219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIR3DS1/CD158e2 Products

Bioinformatics Tool for KIR3DS1/CD158e2 Antibody (NBP3-09219)

Discover related pathways, diseases and genes to KIR3DS1/CD158e2 Antibody (NBP3-09219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIR3DS1/CD158e2 Antibody (NBP3-09219)

Discover more about diseases related to KIR3DS1/CD158e2 Antibody (NBP3-09219).
 

Pathways for KIR3DS1/CD158e2 Antibody (NBP3-09219)

View related products by pathway.

PTMs for KIR3DS1/CD158e2 Antibody (NBP3-09219)

Learn more about PTMs related to KIR3DS1/CD158e2 Antibody (NBP3-09219).

Blogs on KIR3DS1/CD158e2

There are no specific blogs for KIR3DS1/CD158e2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIR3DS1/CD158e2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIR3DS1