KIR3DL1 Antibody

Western Blot: KIR3DL1 Antibody [H00003811-D01P] - Analysis of KIR3DL1 expression in transfected 293T cell line by KIR3DL1 polyclonal antibody.Lane 1: KIR3DL1 transfected lysate(42.40 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

KIR3DL1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: KIR3DL1 (NP_001077008.1, 1 a.a. - 382 a.a.) full-length human protein. MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK
• Specificity: Reacts with killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIR3DL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIR3DL1 Antibody

• AMB11
• CD158 antigen-like family member E
• CD158e antigen
• CD158E
• CD158e1
• CD158e1/2
• CD158e2
• cl-11
• cl-2
• HLA-BW4-specific inhibitory NK cell receptor
• killer cell immunoglobulin-like receptor 3DL1
• killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail1,nkat3
• killer Ig receptor
• KIR antigen 3DL1
• KIR3DL1
• KIR3DL1/S1
• KIR3DS1
• MGC119726
• MGC119728
• MGC126589
• MGC126591
• MHC class I NK cell receptor
• Natural killer-associated transcript 3
• Nkat3
• NKAT-3
• NKAT3KIR
• NKB1
• NKB1B
• NKB1CD158E1
• NK-receptor
• p70 killer cell inhibitory receptor
• p70 natural killer cell receptor clones CL-2/CL-11
• p70 NK receptor CL-2/CL-11

Background

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIR3DL1
• Entrez:
  • 3811(Human)
• Uniprot:
  • NP_001077008.1(Human)