Kir3.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kir3.1 Protein (NBP1-89770PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kir3.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ3.

Source: E. coli

Amino Acid Sequence: VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89770.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kir3.1 Recombinant Protein Antigen

  • G protein-activated inward rectifier potassium channel 1
  • GIRK1
  • GIRK-1
  • GIRK1Kir3.1
  • Inward rectifier K(+) channel Kir3.1
  • inward rectifier K+ channel KIR3.1
  • KCNJ3
  • KGA
  • Kir3.1
  • Potassium channel, inwardly rectifying subfamily J member 3
  • potassium inwardly-rectifying channel, subfamily J, member 3

Background

G protein-coupled inwardly rectifying potassium channels (KIR3.1 through KIR3.4) are coupled to numerous neurotransmitter receptors in the brain and are abundantly expressed in the olfactory bulb, hippocampus, neocortex, dentate gyrus, cerebellar cortex and thalamus regions of the brain. Also known as GIRK, KIR3 potassium channels localize to the soma and dendrites as well as axons of neurons. Liberated Gbgamma subunits from G protein heterotrimers bind to and regulate KIR3 channel activity. Gb3- and Gb4-containing Gbgamma dimers bind directly to cytoplasmic domains of KIR3 proteins and increase the K+ current while Gb5-containing Gbgamma dimers inhibit KIR3 K+ current. KIR3 activity is also inhibited by tyrosine phosphorylation. Brain-derived neurotrophic factor activates receptor tyrosine kinase B, which then phosphorylates KIR3 tyrosine residues, effectively inactivating the KIR3 channels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88081
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-74575
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP2-57515
Species: Hu
Applications: IHC,  IHC-P
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-71896
Species: Hu
Applications: IP, WB
NLS1331
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC,  IHC-P
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32521
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF640
Species: Mu
Applications: IHC, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NBP3-25636
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Kir3.1 Protein (NBP1-89770PEP) (0)

There are no publications for Kir3.1 Protein (NBP1-89770PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir3.1 Protein (NBP1-89770PEP) (0)

There are no reviews for Kir3.1 Protein (NBP1-89770PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kir3.1 Protein (NBP1-89770PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kir3.1 Products

Research Areas for Kir3.1 Protein (NBP1-89770PEP)

Find related products by research area.

Blogs on Kir3.1

There are no specific blogs for Kir3.1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kir3.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ3