KIR2DS4/CD158i Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIR2DS4/CD158i (NP_001268900.1). Peptide sequence FLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHRE |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KIR2DS4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for KIR2DS4/CD158i Antibody - BSA Free
Background
The KIR family consists of transmembrane glycoproteins of the Ig superfamily expressed on human NK cells and a subset of human T cells which they are involved in recognition of either MHC class I molecules or unknown ligand on target cells and inhibit cytotoxic activities. KIR2DS4 is an activating receptor of KIR family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu
Applications: Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ELISA, IHC
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: Flow
Publications for KIR2DS4/CD158i Antibody (NBP3-10034) (0)
There are no publications for KIR2DS4/CD158i Antibody (NBP3-10034).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIR2DS4/CD158i Antibody (NBP3-10034) (0)
There are no reviews for KIR2DS4/CD158i Antibody (NBP3-10034).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIR2DS4/CD158i Antibody (NBP3-10034) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIR2DS4/CD158i Products
Research Areas for KIR2DS4/CD158i Antibody (NBP3-10034)
Find related products by research area.
|
Blogs on KIR2DS4/CD158i