KIR2DL5/CD158f Antibody - Azide and BSA Free

Western Blot: KIR2DL5/CD158f Antibody [H00057292-B01P] - Analysis of KIR2DL5A expression in transfected 293T cell line by KIR2DL5A polyclonal antibody. Lane 1: KIR2DL5A transfected lysate(41.25 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KIR2DL5/CD158f Antibody - Azide and BSA Free Summary

• Immunogen: KIR2DL5A (AAI60063.1, 1 a.a. - 375 a.a.) full-length human protein. MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KIR2DL5A
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIR2DL5/CD158f Antibody - Azide and BSA Free

• CD158f
• CD158F1
• killer cell immunoglobulin-like receptor 2DL5A
• killer cell immunoglobulin-like receptor KIR2DL5A
• killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5
• killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A
• killer-cell Ig-like receptor
• KIR2DL5
• KIR2DL5.1
• KIR2DL5.3
• KIR2DL5A
• KIR2DL5B

Background

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells andsubsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies amonghaplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4,KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and bywhether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduceinhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins withthe short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase bindingprotein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules;thus, KIR proteins are thought to play an important role in regulation of the immune response. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIR2DL5A
• Uniprot:
  • AAI60063.1(Human)