KIF22 Recombinant Protein Antigen

Images

 
There are currently no images for KIF22 Protein (NBP1-82876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF22.

Source: E.coli

Amino Acid Sequence: SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82876.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF22 Recombinant Protein Antigen

  • Kid
  • KIDA-328A3.2
  • kinesin family member 22
  • kinesin-like 4
  • Kinesin-like DNA-binding protein
  • Kinesin-like protein 4
  • kinesin-like protein KIF22
  • KNSL4kinesin-like DNA-binding protein pseudogene
  • OBP
  • OBP-1
  • OBP-2
  • origin of plasmid DNA replication-binding protein
  • oriP binding protein

Background

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-20231
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-03027
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46198
Species: Hu
Applications: IHC, WB
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
AF2200
Species: Hu
Applications: IP, WB
NBP1-83289
Species: Hu
Applications: IHC, IHC-P, WB
H00007884-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NBP1-82876PEP
Species: Hu
Applications: AC

Publications for KIF22 Protein (NBP1-82876PEP) (0)

There are no publications for KIF22 Protein (NBP1-82876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF22 Protein (NBP1-82876PEP) (0)

There are no reviews for KIF22 Protein (NBP1-82876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF22 Protein (NBP1-82876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF22 Products

Bioinformatics Tool for KIF22 Protein (NBP1-82876PEP)

Discover related pathways, diseases and genes to KIF22 Protein (NBP1-82876PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF22 Protein (NBP1-82876PEP)

Discover more about diseases related to KIF22 Protein (NBP1-82876PEP).
 

Pathways for KIF22 Protein (NBP1-82876PEP)

View related products by pathway.

PTMs for KIF22 Protein (NBP1-82876PEP)

Learn more about PTMs related to KIF22 Protein (NBP1-82876PEP).
 

Research Areas for KIF22 Protein (NBP1-82876PEP)

Find related products by research area.

Blogs on KIF22

There are no specific blogs for KIF22, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF22 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF22