KIF22 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

KIF22 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF22.
  
  

  Source: E.coli

  Amino Acid Sequence: SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KIF22
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-82876.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF22 Recombinant Protein Antigen

• Kid
• KIDA-328A3.2
• kinesin family member 22
• kinesin-like 4
• Kinesin-like DNA-binding protein
• Kinesin-like protein 4
• kinesin-like protein KIF22
• KNSL4kinesin-like DNA-binding protein pseudogene
• OBP
• OBP-1
• OBP-2
• origin of plasmid DNA replication-binding protein
• oriP binding protein

Background

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF22