Home » KIF20A » KIF20A Proteins » KIF20A Recombinant Protein Antigen

KIF20A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KIF20A Protein (NBP1-87176PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

KIF20A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF20A.

Source: E.coli

Amino Acid Sequence: DDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFAL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF20A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87176.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for KIF20A Recombinant Protein Antigen

  • FLJ21151
  • GG10_2
  • kinesin family member 20A
  • kinesin-like protein KIF20A
  • mitotic kinesin-like protein 2
  • MKLP2
  • Rab6-interacting kinesin-like protein
  • RAB6KIFLkinesin-like (rabkinesin6)
  • rabkinesin-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLK1 Antibody
NB100-56651
Western Blot: PLK1 Antibody [NB100-56651] - Analysis of HCT-116 lysate using PLK1 antibody at 1:2000.
Immunohistochemistry-Paraffin: PLK1 Antibody [NB100-56651] - Analysis of human placenta using PLK1 antibody at 1:100.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MKLP1 Antibody
(SY02-74)
NBP2-67446
Western Blot: MKLP1 Antibody (SY02-74) [NBP2-67446] - Analysis of MKLP1 on different lysates using anti-MKLP1 antibody at 1/1,000 dilution. Positive control: Lane 1: A549 Lane 2: Hela
Immunocytochemistry/Immunofluorescence: MKLP1 Antibody (SY02-74) [NBP2-67446] - Staining MKLP1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: MKLP1 Antibody (SY02-74) [NBP2-67446] - Staining MKLP1 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
RAB6A Antibody
NBP1-33110
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Aurora B Antibody
NB100-294
Immunocytochemistry/Immunofluorescence: Aurora B Antibody [NB100-294] - RPE1 cells stained with Aurora B antibody (green). Image from verified customer review.
Immunohistochemistry: Aurora B Antibody [NB100-294] - Rabbit polyclonal to Aurora B (NB100-294) used to stain SW620 human tumour xenografts (in mouse). The sections were microwave pretreated in citrate buffer (pH 6.0) for 5 mins high then 5 mins simmer (800W conventional microwave). Slides were then incubated for 1 hour with the Aurora B primary antibody diluted 1/200 in TBS, then visualised using DAB, after application of an appropriate secondary.
Chromatin Immunoprecipitation: Aurora B Antibody [NB100-294] - 293T cells stained with Aurora B antibody. Image from verified customer review.
(5 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
MAD2L1 Antibody
NB100-563
Immunohistochemistry: MAD2L1 Antibody [NB100-563] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- MAD2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MAD2L1 Antibody [NB100-563] - Detection of human MAD2L1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MAD2L1 antibody NB100-563 (lot 3) used for IP at 3 ug/mg lysate. MAD2L1 was also immunoprecipitated by a previous lot (lot 2) and by rabbit anti-MAD2L1 antibody NB100-564. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(14 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
XIAP Antibody
NB100-56183
Western Blot: XIAP Antibody - Unpurified [NB100-56183] - Analysis of XIAP in various tumor cell lines using this antibody at 1:2000.
Immunohistochemistry-Paraffin: XIAP Antibody - Unpurified [NB100-56183] - Human breast carcinoma using this antibody at 1:2000. A-A3, successively higher magnifications of the breast carcinoma tissue section. Hematoxylin-eosin counterstain.
Western Blot: XIAP Antibody - Unpurified [NB100-56183] - XIAP Antibody [NB100-56183] - Analysis of recombinant full-length IAP proteins using this antibody to XIAP at 1:2000. The data shows that the antibody recognizes only XIAP and not the other IAP proteins.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
HIV-1 Rev binding
protein (HRB) Antibod ...
NBP1-91991
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KIF15 Antibody
NBP2-34009
Immunohistochemistry-Paraffin: KIF15 Antibody [NBP2-34009] - staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: KIF15 Antibody [NBP2-34009] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts and strong nuclear staining in leydig cells.
Species: Hu
Applications: IHC, IHC-P
Eg5 Antibody
NB500-181
Western Blot: Eg5 Antibody [NB500-181] - Cells were transfected with the pCMV6-ENTRY control or pCMV6-ENTRY KIF11 cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Eg5.
Immunocytochemistry/Immunofluorescence: Eg5 Antibody [NB500-181] - Staining of HeLa cells fixed in 3.5% paraformaldehyde. Cytoplasmic staining during interphase and spindle staining during mitosis.
Western Blot: Eg5 Antibody [NB500-181] - Human Eg5 rescues depletion of the Drosophila kinesin-5 family member Klp61F. Western blot analysis of cell lysates prepared from induced and uninduced; control and Klp61F RNAi-treated cells blotted with anti-Eg5 to monitor induction of Eg5-mCherry, anti-Klp61F to confirm depletion of the motor and anti-alpha-tubulin as a loading control. Cells depleted of Klp61F and with Eg5-mCherry induced are referred to as RepEg5 cells. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fonc.2013.00187/abstract), licensed under a CC-BY licence.
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Po, Dr, Ma, Pl
Applications: WB, IB, ICC/IF, IP
INCENP Antibody
(3D2)
NBP2-37471
Western Blot: INCENP Antibody (3D2) [NBP2-37471] - Analysis using INCENP mAb against HEK293 (1) and INCENP (AA: 369-583)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: INCENP Antibody (3D2) [NBP2-37471] - Immunofluorescence analysis of HepG2 cells using INCENP mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: INCENP Antibody (3D2) [NBP2-37471] - Analysis of rectum cancer tissues using INCENP mouse mAb with DAB staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
KIF1B Antibody
NB100-57493
Western Blot: KIF1B Antibody [NB100-57493] - Detection of Human and Mouse KIF1B on HeLa whole cell lysate using NB100-57493. KIF1B was also immunoprecipitated by rabbit anti-KIF1B antibody NB100-57494.
(3 Publications)
Species: Hu, Mu
Applications: WB, IP
Aurora B Antibody
NB100-294
Immunocytochemistry/Immunofluorescence: Aurora B Antibody [NB100-294] - RPE1 cells stained with Aurora B antibody (green). Image from verified customer review.
Immunohistochemistry: Aurora B Antibody [NB100-294] - Rabbit polyclonal to Aurora B (NB100-294) used to stain SW620 human tumour xenografts (in mouse). The sections were microwave pretreated in citrate buffer (pH 6.0) for 5 mins high then 5 mins simmer (800W conventional microwave). Slides were then incubated for 1 hour with the Aurora B primary antibody diluted 1/200 in TBS, then visualised using DAB, after application of an appropriate secondary.
Chromatin Immunoprecipitation: Aurora B Antibody [NB100-294] - 293T cells stained with Aurora B antibody. Image from verified customer review.
(5 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
APOL3 Antibody
NBP1-06979
Western Blot: APOL3 Antibody [NBP1-06979] - NBP1-06979 (1ug/ml) staining of DAUDI lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Mxi1 Antibody
NBP1-88626
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Mxi1 Antibody [NBP1-88626] - Staining of human skin shows moderate to strong nuclear positivity in epidermal cells.
Species: Hu
Applications: IHC, IHC-P
Apolipoprotein L1
Antibody
NBP1-89033
Western Blot: Apolipoprotein L1 Antibody [NBP1-89033] - Analysis in human cell lines A-431 and MCF-7 using anti-APOL1 antibody. Corresponding APOL1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Apolipoprotein L1 Antibody [NBP1-89033] - Staining of vascular BM whole mounts with antibodies to proteins detected in the proteome analysis. The same treatment of vascular BM whole mounts from non-diabetic eyes did not show staining for these proteins. Diabetes-related changes in the protein composition and the biomechanical properties of human retinal vascular basement membranes. PLoS One (2017)
Immunohistochemistry-Paraffin: Apolipoprotein L1 Antibody [NBP1-89033] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
(3 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Citron Kinase
Antibody
NBP1-88050
Immunohistochemistry-Paraffin: Citron Kinase Antibody [NBP1-88050] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Citron Kinase Antibody [NBP1-88050] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Citron Kinase Antibody [NBP1-88050] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P
Survivin Antibody
NB500-201
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Western Blot: Survivin Antibody [NB500-201] - Analysis of 30ug of HeLa whole cell lysate [NB800-PC1] using rabbit polyclonal [NB500-201] at 1ug/ml. Detection was performed using ECL method with 1 minute exposure. Band detected at higher molecular weight than the predicted MW (16 kDa).
Immunocytochemistry/Immunofluorescence: Survivin Antibody [NB500-201] - Analysis using the HRP conjugate of [NB500-201]. Staining of Telophase with accumulation of survivin in the midbodies of two daughter cells. Survivin detection using [NB500-201].
(22 Reviews)
(344 Publications)
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
Survivin Antibody
NB500-201
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Western Blot: Survivin Antibody [NB500-201] - Analysis of 30ug of HeLa whole cell lysate [NB800-PC1] using rabbit polyclonal [NB500-201] at 1ug/ml. Detection was performed using ECL method with 1 minute exposure. Band detected at higher molecular weight than the predicted MW (16 kDa).
Immunocytochemistry/Immunofluorescence: Survivin Antibody [NB500-201] - Analysis using the HRP conjugate of [NB500-201]. Staining of Telophase with accumulation of survivin in the midbodies of two daughter cells. Survivin detection using [NB500-201].
(22 Reviews)
(344 Publications)
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
KIF20A Recombinant
Protein Antigen
NBP1-87176PEP
KIF20A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for KIF20A Protein (NBP1-87176PEP) (0)

There are no publications for KIF20A Protein (NBP1-87176PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF20A Protein (NBP1-87176PEP) (0)

There are no reviews for KIF20A Protein (NBP1-87176PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF20A Protein (NBP1-87176PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional KIF20A Products

Bioinformatics Tool for KIF20A Protein (NBP1-87176PEP)

Discover related pathways, diseases and genes to KIF20A Protein (NBP1-87176PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF20A Protein (NBP1-87176PEP)

Discover more about diseases related to KIF20A Protein (NBP1-87176PEP).
 

Pathways for KIF20A Protein (NBP1-87176PEP)

View related products by pathway.

Research Areas for KIF20A Protein (NBP1-87176PEP)

Find related products by research area.

Blogs on KIF20A

There are no specific blogs for KIF20A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Dual RNAscope ISH-IHC: Survivin Antibody [NB500-201] - Formalin-fixed paraffin-embedded tissue sections of human esophagus squamous cell carcinoma were probed for Survivin mRNA (ACD RNAScope Probe, [465361]; Fast Red chromogen, ACD [322360]). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal [NB500-201] at 1.5ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-rabbit IgG VisUCyte HRP Polymer Antibody [VC003] and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to tumor cells.
Survivin Antibody
NB500-201

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF20A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KIF20A