KIF1C Recombinant Protein Antigen

Images

 
There are currently no images for KIF1C Protein (NBP1-85978PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF1C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF1C.

Source: E. coli

Amino Acid Sequence: SGEAPTPLQPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF1C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85978.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIF1C Recombinant Protein Antigen

  • KIAA0706
  • kinesin family member 1C
  • kinesin-like protein KIF1C
  • LTXS1

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF1C, also known as LTXS1 (lethal toxin sensitivity), has been found to be localized to the golgi and the endoplasmic reticulum (ER) and play a role in vesicle transport between the golgi and ER. Alternate identifiers of KIF1C include kinesin family member 1C, kinesin-like protein KIF1C and KIAA0706.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

211-TBB/CF
Species: Hu
Applications: BA
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP3-46391
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC,  IHC-P, S-ELISA, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-05030
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-80033
Species: Hu
Applications: WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB100-40844
Species: Hu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-41418
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-84187
Species: Hu
Applications: IHC,  IHC-P
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB500-182
Species: Hu, Ma, Mu, Rt
Applications: ICC/IF, IP, WB
AF7116
Species: Hu
Applications: WB
NBP2-52508
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC,  IHC-P, WB
H00006223-M01
Species: Hu, Mu
Applications: ELISA, WB
NBP1-85978PEP
Species: Hu
Applications: AC

Publications for KIF1C Protein (NBP1-85978PEP) (0)

There are no publications for KIF1C Protein (NBP1-85978PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF1C Protein (NBP1-85978PEP) (0)

There are no reviews for KIF1C Protein (NBP1-85978PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF1C Protein (NBP1-85978PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF1C Products

Array NBP1-85978PEP

Research Areas for KIF1C Protein (NBP1-85978PEP)

Find related products by research area.

Blogs on KIF1C

There are no specific blogs for KIF1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF1C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF1C