![Immunocytochemistry/Immunofluorescence: KIAA1257 Antibody [NBP2-38582] - Staining of human cell line AF22 shows localization to cytosol.](http://images.novusbio.com/fullsize2/KIAA1257-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38582-img0002.jpg "Immunocytochemistry/Immunofluorescence: KIAA1257 Antibody [NBP2-38582] - Staining of human cell line AF22 shows localization to cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EPISSITSFYQSTSECDVEEHLKAKARAQESDSDRPCSSIESSSEPASTFSSDVPHVVPCKFTISLAFPVNMGQKGKYASLIEKYKKHPKTDSSVTKMRR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIAA1257 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunocytochemistry-Immunofluorescence-NBP2-88921-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-88921-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-88921-img0003.jpg)
-ELISA-NBP2-37463-img0001.jpg)
-Western-Blot-NBP2-37463-img0002.jpg)
-Western-Blot-NBP2-37463-img0003.jpg)
-Immunohistochemistry-Paraffin-NBP2-03442-img0003.jpg)
-Western-Blot-NBP2-03442-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Pathways for KIAA1257 Antibody (NBP2-38582)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: KIAA1257 Antibody [NBP2-38582] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/KIAA1257-Antibody-Immunohistochemistry-NBP2-38582-img0001.jpg "Immunohistochemistry: KIAA1257 Antibody [NBP2-38582] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
-Immunoprecipitation-H00007004-M01-img0006.jpg)
-Western-Blot-H00007004-M01-img0007.jpg)
-Western-Blot-H00007004-M01-img0010.jpg)
![Western Blot SOX15 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX15_AF4070_Western_Blot_5397.jpg)
![Immunocytochemistry SOX15 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX15_AF4070_Immunocytochemistry__Immunofluorescence_19727.jpg)
![Immunocytochemistry SOX15 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4070_human-sox15-affinity-purified-polyclonal-ab-immunocytochemistry-243202213427.jpg)
![Bioactivity ICOS [Unconjugated]](https://images.novusbio.com/images2/ICOS_169CS_2302.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")