KIAA1210 Antibody

Images

 
Immunohistochemistry-Paraffin: KIAA1210 Antibody [NBP2-48902] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: KIAA1210 Antibody [NBP2-48902] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: KIAA1210 Antibody [NBP2-48902] - Staining in human testis and tonsil tissues using anti-KIAA1210 antibody. Corresponding KIAA1210 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KIAA1210 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NLVEISLDDESPKNPQKKALPHKSLTATQSFSELSSGPDCSQSLTAFATLASTSSTQLPIGFSTPATTQGCLDSSAARHKMTLNPRKQKKN
Specificity
Specificity of human KIAA1210 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1210
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIAA1210 Recombinant Protein Antigen (NBP2-48902PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1210 Antibody

  • hypothetical protein LOC57481
  • KIAA1210

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32508
Species: Hu
Applications: IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC, KO
NBP2-30589
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP2-25221
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88937
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48902
Species: Hu
Applications: IHC, IHC-P

Publications for KIAA1210 Antibody (NBP2-48902) (0)

There are no publications for KIAA1210 Antibody (NBP2-48902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1210 Antibody (NBP2-48902) (0)

There are no reviews for KIAA1210 Antibody (NBP2-48902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIAA1210 Antibody (NBP2-48902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIAA1210 Products

Bioinformatics Tool for KIAA1210 Antibody (NBP2-48902)

Discover related pathways, diseases and genes to KIAA1210 Antibody (NBP2-48902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1210 Antibody (NBP2-48902)

Discover more about diseases related to KIAA1210 Antibody (NBP2-48902).
 

Pathways for KIAA1210 Antibody (NBP2-48902)

View related products by pathway.

PTMs for KIAA1210 Antibody (NBP2-48902)

Learn more about PTMs related to KIAA1210 Antibody (NBP2-48902).

Blogs on KIAA1210

There are no specific blogs for KIAA1210, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1210 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1210