Kelch-Like 3 Antibody

Images

 
Western Blot: Kelch-Like 3 Antibody [NBP2-87676] - WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kelch-Like 3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Kelch-Like 3. Peptide sequence: LYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kelch-Like 3 Antibody

  • FLJ40871
  • kelch-like 3 (Drosophila)
  • kelch-like protein 3
  • KIAA1129kelch (Drosophila)-like 3
  • MGC44594

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-58788
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-02939
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
NB600-284
Species: Hu, Mu, Rt
Applications: EM, ICC/IF (-), IHC, IHC-Fr, IHC-P, IP, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP2-87689
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
AF756
Species: Mu
Applications: IHC, WB
NBP2-37898
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1914
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NBP2-67818
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB

Publications for Kelch-Like 3 Antibody (NBP2-87676) (0)

There are no publications for Kelch-Like 3 Antibody (NBP2-87676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kelch-Like 3 Antibody (NBP2-87676) (0)

There are no reviews for Kelch-Like 3 Antibody (NBP2-87676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kelch-Like 3 Antibody (NBP2-87676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kelch-Like 3 Products

Bioinformatics Tool for Kelch-Like 3 Antibody (NBP2-87676)

Discover related pathways, diseases and genes to Kelch-Like 3 Antibody (NBP2-87676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kelch-Like 3 Antibody (NBP2-87676)

Discover more about diseases related to Kelch-Like 3 Antibody (NBP2-87676).
 

Pathways for Kelch-Like 3 Antibody (NBP2-87676)

View related products by pathway.

PTMs for Kelch-Like 3 Antibody (NBP2-87676)

Learn more about PTMs related to Kelch-Like 3 Antibody (NBP2-87676).
 

Research Areas for Kelch-Like 3 Antibody (NBP2-87676)

Find related products by research area.

Blogs on Kelch-Like 3

There are no specific blogs for Kelch-Like 3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kelch-Like 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL3