KCTD8 Antibody

Immunohistochemistry-Paraffin: KCTD8 Antibody [NBP1-86327] - Staining in human cerebral cortex and pancreas tissues using anti-KCTD8 antibody. Corresponding KCTD8 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: KCTD8 Antibody [NBP1-86327] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KCTD8 Antibody [NBP1-86327] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: KCTD8 Antibody [NBP1-86327] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KCTD8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCTD8 Protein (NBP1-86327PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCTD8 Antibody

• potassium channel tetramerisation domain containing 8

Background

KCTD8, also known as BTB/POZ domain-containing protein KCTD8, is a 52 kDa 473 amino acid protein, and is involved in the determination of the drug effects and dynamics of the receptor response in the synapse. This protein has also been shown to have interactions with EGFR in the Sweet Taste Signaling, Activation of cAMP-Dependent PKA, Neuropathic Pain-Signaling in Dorsal Horn Neurons, and Hepatic ABC Transporters pathways. KCTD8 is also called Potassium Channel Tetramerisation Domain Containing 8.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD8