KCTD8 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit KCTD8 Antibody - BSA Free (NBP1-86327) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KCTD8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KCTD8 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%).
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for KCTD8 Antibody - BSA Free
Background
KCTD8, also known as BTB/POZ domain-containing protein KCTD8, is a 52 kDa 473 amino acid protein, and is involved in the determination of the drug effects and dynamics of the receptor response in the synapse. This protein has also been shown to have interactions with EGFR in the Sweet Taste Signaling, Activation of cAMP-Dependent PKA, Neuropathic Pain-Signaling in Dorsal Horn Neurons, and Hepatic ABC Transporters pathways. KCTD8 is also called Potassium Channel Tetramerisation Domain Containing 8.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Rt
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for KCTD8 Antibody (NBP1-86327)(1)
Showing Publication 1 -
1 of 1.
Reviews for KCTD8 Antibody (NBP1-86327) (0)
There are no reviews for KCTD8 Antibody (NBP1-86327).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCTD8 Antibody (NBP1-86327) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCTD8 Products
Blogs on KCTD8