KCTD8 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KCTD8 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%).
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for KCTD8 Antibody
Background
KCTD8, also known as BTB/POZ domain-containing protein KCTD8, is a 52 kDa 473 amino acid protein, and is involved in the determination of the drug effects and dynamics of the receptor response in the synapse. This protein has also been shown to have interactions with EGFR in the Sweet Taste Signaling, Activation of cAMP-Dependent PKA, Neuropathic Pain-Signaling in Dorsal Horn Neurons, and Hepatic ABC Transporters pathways. KCTD8 is also called Potassium Channel Tetramerisation Domain Containing 8.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Rt
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for KCTD8 Antibody (NBP1-86327) (0)
There are no publications for KCTD8 Antibody (NBP1-86327).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCTD8 Antibody (NBP1-86327) (0)
There are no reviews for KCTD8 Antibody (NBP1-86327).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCTD8 Antibody (NBP1-86327) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCTD8 Products
Bioinformatics Tool for KCTD8 Antibody (NBP1-86327)
Discover related pathways, diseases and genes to KCTD8 Antibody (NBP1-86327). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KCTD8 Antibody (NBP1-86327)
Discover more about diseases related to KCTD8 Antibody (NBP1-86327).
| | Pathways for KCTD8 Antibody (NBP1-86327)
View related products by pathway.
|
PTMs for KCTD8 Antibody (NBP1-86327)
Learn more about PTMs related to KCTD8 Antibody (NBP1-86327).
|
Blogs on KCTD8