KCNJ1 Recombinant Protein Antigen

Images

 
There are currently no images for KCNJ1 Protein (NBP1-82874PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCNJ1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNJ1.

Source: E. coli

Amino Acid Sequence: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNJ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82874.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNJ1 Recombinant Protein Antigen

  • ATP-regulated potassium channel ROM-K
  • ATP-sensitive inward rectifier potassium channel 1
  • inwardly rectifying K+ channel
  • KIR1.1
  • potassium inwardly-rectifying channel, subfamily J, member 1
  • ROMK1inwardly rectifying subfamily J member 1

Background

FUNCTION: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.; Tissue specificity: In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-284
Species: Hu, Mu, Rt
Applications: EM, ICC/IF (-), IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-10348
Species: Hu
Applications: WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88109
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74575
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP2-59324
Species: Ma, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for KCNJ1 Protein (NBP1-82874PEP) (0)

There are no publications for KCNJ1 Protein (NBP1-82874PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNJ1 Protein (NBP1-82874PEP) (0)

There are no reviews for KCNJ1 Protein (NBP1-82874PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCNJ1 Protein (NBP1-82874PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNJ1 Products

Research Areas for KCNJ1 Protein (NBP1-82874PEP)

Find related products by research area.

Blogs on KCNJ1

There are no specific blogs for KCNJ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCNJ1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ1