KCC1/SLC12A4 Recombinant Protein Antigen

Images

 
There are currently no images for KCC1/SLC12A4 Protein (NBP1-83067PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCC1/SLC12A4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC12A4.

Source: E. coli

Amino Acid Sequence: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC12A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83067.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCC1/SLC12A4 Recombinant Protein Antigen

  • Electroneutral potassium-chloride cotransporter 1
  • Erythroid K-Cl cotransporter 1
  • FLJ17069
  • FLJ40489
  • hKCC1
  • KCC1
  • KCC1erythroid K:Cl cotransporter
  • K-Cl cotransporter
  • potassium/chloride cotransporter 1
  • SLC12A4
  • solute carrier family 12 (potassium/chloride transporters), member 4
  • solute carrier family 12 member 4

Background

Potassium-chloride cotransporters mediate the coupled movement of potassium and chloride ions across the plasma membrane. SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling and may contribute to cell volume homeostasis in single cells. SLC12A4 may play a role in early erythroid maturation events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-13161
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB9030
Species: Hu
Applications: CyTOF-ready, Flow
NB100-75623
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
640-A3
Species: Mu
Applications: Bind
NBP2-93100
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-85501
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-62178
Species: Hu, Mu, Rt
Applications: ELISA
MAB25031
Species: Hu
Applications: IHC, IP, WB

Publications for KCC1/SLC12A4 Protein (NBP1-83067PEP) (0)

There are no publications for KCC1/SLC12A4 Protein (NBP1-83067PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCC1/SLC12A4 Protein (NBP1-83067PEP) (0)

There are no reviews for KCC1/SLC12A4 Protein (NBP1-83067PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCC1/SLC12A4 Protein (NBP1-83067PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCC1/SLC12A4 Products

Bioinformatics Tool for KCC1/SLC12A4 Protein (NBP1-83067PEP)

Discover related pathways, diseases and genes to KCC1/SLC12A4 Protein (NBP1-83067PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC1/SLC12A4 Protein (NBP1-83067PEP)

Discover more about diseases related to KCC1/SLC12A4 Protein (NBP1-83067PEP).
 

Pathways for KCC1/SLC12A4 Protein (NBP1-83067PEP)

View related products by pathway.

PTMs for KCC1/SLC12A4 Protein (NBP1-83067PEP)

Learn more about PTMs related to KCC1/SLC12A4 Protein (NBP1-83067PEP).

Blogs on KCC1/SLC12A4

There are no specific blogs for KCC1/SLC12A4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCC1/SLC12A4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A4