KAT2A/GCN5 Antibody

Western Blot: KAT2A/GCN5 Antibody [NBP2-14140] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: KAT2A/GCN5 Antibody [NBP2-14140] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Discontinued

KAT2A/GCN5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYK
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KAT2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KAT2A/GCN5 Antibody

• EC 2.3.1.48
• GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
• GCN5L2
• GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
• GCN5MGC102791
• General control of amino acid synthesis protein 5-like 2
• General control of amino acid synthesis, yeast, homolog-like 2
• HGCN5
• Histone acetyltransferase GCN5
• histone acetyltransferase KAT2A
• hsGCN5
• K(lysine) acetyltransferase 2A
• KAT2A
• KAT2A/GCN5
• Lysine acetyltransferase 2A
• PCAF-B
• STAF97

Background

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It alsofunctions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA(MIM 164014) in a HAT-independent manner (Mao et al., 2009 (PubMed 19339690)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KAT2A