KAT2A/GCN5 Antibody


Immunohistochemistry-Paraffin: KAT2A/GCN5 Antibody [NBP2-14140] Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

KAT2A/GCN5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYK
Specificity of human KAT2A/GCN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KAT2A/GCN5 Protein (NBP2-14140PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KAT2A/GCN5 Antibody

  • EC
  • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
  • GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
  • GCN5MGC102791
  • General control of amino acid synthesis protein 5-like 2
  • General control of amino acid synthesis, yeast, homolog-like 2
  • hGCN5
  • Histone acetyltransferase GCN5
  • histone acetyltransferase KAT2A
  • hsGCN5
  • K(lysine) acetyltransferase 2A
  • Lysine acetyltransferase 2A
  • PCAF-b
  • STAF97


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC

Publications for KAT2A/GCN5 Antibody (NBP2-14140) (0)

There are no publications for KAT2A/GCN5 Antibody (NBP2-14140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT2A/GCN5 Antibody (NBP2-14140) (0)

There are no reviews for KAT2A/GCN5 Antibody (NBP2-14140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KAT2A/GCN5 Antibody (NBP2-14140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KAT2A/GCN5 Products

Bioinformatics Tool for KAT2A/GCN5 Antibody (NBP2-14140)

Discover related pathways, diseases and genes to KAT2A/GCN5 Antibody (NBP2-14140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT2A/GCN5 Antibody (NBP2-14140)

Discover more about diseases related to KAT2A/GCN5 Antibody (NBP2-14140).

Pathways for KAT2A/GCN5 Antibody (NBP2-14140)

View related products by pathway.

PTMs for KAT2A/GCN5 Antibody (NBP2-14140)

Learn more about PTMs related to KAT2A/GCN5 Antibody (NBP2-14140).

Blogs on KAT2A/GCN5

There are no specific blogs for KAT2A/GCN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KAT2A/GCN5 Antibody and receive a gift card or discount.


Gene Symbol KAT2A