KAT2A/GCN5 Antibody (4D3)

Images

 
Western Blot: KAT2A/GCN5 Antibody (4D3) [H00002648-M01] - GCN5L2 monoclonal antibody (M01), clone 4D3 Analysis of GCN5L2 expression in K-562.
Immunocytochemistry/ Immunofluorescence: KAT2A/GCN5 Antibody (4D3) [H00002648-M01] - Analysis of monoclonal antibody to GCN5L2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KAT2A/GCN5 Antibody (4D3) Summary

Immunogen
GCN5L2 (AAH32743 738 a.a. - 837 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Specificity
GCN5L2 - GCN5 general control of amino-acid synthesis 5-like 2 (yeast) (4D3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KAT2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KAT2A/GCN5 Antibody (4D3)

  • EC 2.3.1.48
  • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
  • GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
  • GCN5MGC102791
  • General control of amino acid synthesis protein 5-like 2
  • General control of amino acid synthesis, yeast, homolog-like 2
  • hGCN5
  • Histone acetyltransferase GCN5
  • histone acetyltransferase KAT2A
  • hsGCN5
  • K(lysine) acetyltransferase 2A
  • Lysine acetyltransferase 2A
  • PCAF-b
  • STAF97

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-57507
Species: Hu
Applications: ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
AF7365
Species: Hu, Mu, Rt
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-45466
Species: Hu
Applications: WB, IHC

Publications for KAT2A/GCN5 Antibody (H00002648-M01) (0)

There are no publications for KAT2A/GCN5 Antibody (H00002648-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT2A/GCN5 Antibody (H00002648-M01) (0)

There are no reviews for KAT2A/GCN5 Antibody (H00002648-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KAT2A/GCN5 Antibody (H00002648-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT2A/GCN5 Products

Bioinformatics Tool for KAT2A/GCN5 Antibody (H00002648-M01)

Discover related pathways, diseases and genes to KAT2A/GCN5 Antibody (H00002648-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT2A/GCN5 Antibody (H00002648-M01)

Discover more about diseases related to KAT2A/GCN5 Antibody (H00002648-M01).
 

Pathways for KAT2A/GCN5 Antibody (H00002648-M01)

View related products by pathway.

PTMs for KAT2A/GCN5 Antibody (H00002648-M01)

Learn more about PTMs related to KAT2A/GCN5 Antibody (H00002648-M01).

Blogs on KAT2A/GCN5

There are no specific blogs for KAT2A/GCN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT2A/GCN5 Antibody (4D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT2A
Entrez
Uniprot