Kallikrein 10 Antibody Summary
Immunogen |
KLK10 (AAH02710.1, 1 a.a. - 276 a.a.) full-length human protein. MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN |
Specificity |
KLK10 - kallikrein-related peptidase 10, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
KLK10 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Kallikrein 10 Antibody
Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
Species: Hu
Applications: WB
Publications for Kallikrein 10 Antibody (H00005655-B01P) (0)
There are no publications for Kallikrein 10 Antibody (H00005655-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 10 Antibody (H00005655-B01P) (0)
There are no reviews for Kallikrein 10 Antibody (H00005655-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kallikrein 10 Antibody (H00005655-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 10 Products
Bioinformatics Tool for Kallikrein 10 Antibody (H00005655-B01P)
Discover related pathways, diseases and genes to Kallikrein 10 Antibody (H00005655-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Kallikrein 10 Antibody (H00005655-B01P)
Discover more about diseases related to Kallikrein 10 Antibody (H00005655-B01P).
| | Pathways for Kallikrein 10 Antibody (H00005655-B01P)
View related products by pathway.
|
PTMs for Kallikrein 10 Antibody (H00005655-B01P)
Learn more about PTMs related to Kallikrein 10 Antibody (H00005655-B01P).
| | Research Areas for Kallikrein 10 Antibody (H00005655-B01P)
Find related products by research area.
|
Blogs on Kallikrein 10