Home » Kallikrein 10 » Kallikrein 10 Antibodies » Kallikrein 10 Antibody

Kallikrein 10 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Kallikrein 10 Antibody [H00005655-B01P] - Analysis of KLK10 expression in transfected 293T cell line by KLK10 polyclonal antibody. Lane 1: KLK10 transfected lysate(30.36 KDa). Lane 2: Non-transfected lysate.
Western Blot: Kallikrein 10 Antibody [H00005655-B01P] - Analysis of KLK10 expression in transfected 293T cell line by KLK10 polyclonal antibody. Lane 1: KLK10 transfected lysate(30.36 KDa). Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: Kallikrein 10 Antibody [H00005655-B01P] - Immunofluorescence of purified MaxPab antibody to KLK10 on HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kallikrein 10 Antibody Summary

Immunogen
KLK10 (AAH02710.1, 1 a.a. - 276 a.a.) full-length human protein. MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Specificity
KLK10 - kallikrein-related peptidase 10,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KLK10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 10 Antibody

  • breast normal epithelial cell associated serine protease
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.74
  • Kallikrein 10
  • kallikrein-related peptidase 10
  • KLK10
  • NES1
  • NES1kallikrein-10
  • Normal epithelial cell-specific 1
  • Protease serine-like 1
  • PRSSL1protease, serine-like, 1

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(15 Publications)
Species: Hu
Applications: ELISA
Kallikrein
6/Neurosin Antibody
AF2008
Kallikrein 6/Neurosin was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Goat Anti-Human Kallikrein 6/Neurosin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2008) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: IHC, IP, WB
Kallikrein 1
Antibody
AF7928
Western blot shows lysates of mouse pancreas tissue and mouse small intestine. PVDF membrane was probed with 0.25 µg/mL of Sheep Anti-Mouse Kallikrein 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7928) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Kallikrein 1 at approximately 27-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Kallikrein 1 was detected in perfusion fixed frozen sections of mouse kidney using Sheep Anti-Mouse Kallikrein 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7928) at 1.5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to tubules. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: IHC, WB
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, IP, Neut, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western blot shows human plasma. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Protein S/PROS1 at approximately 80 & 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows human plasma, loaded at 0.2 mg/mL. A specific band was detected for Protein S/PROS1 at approximately 106 kDa (as indicated) using 2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(3 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5mm) and enlargement of selected areas (lower panels, scale bars=100um). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3)=0.002, Fisher's exact test. n=5+34. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-017-01178-z), licensed under a CC-BY licence.
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa) .
(10 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - NCI-N87 xenograft, using PSAT1antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human Fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Puromycin-sensitive aminopeptidase/NPEPPS Antibody [NBP2-13669] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Kallikrein 2
Antibody
NBP1-06046
Western Blot: Kallikrein 2 Antibody [NBP1-06046] - Staining of HeLa cell lysate (A) + peptide (B) (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Staining of paraffin embedded Human Prostate. Antibody at 8 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry-Paraffin: Kallikrein 2 Antibody [NBP1-06046] - Negative Control showing staining of paraffin embedded Human Prostate, with no primary antibody.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Kallikrein 5
[Unconjugated]
1108-SE
Recombinant Human Kallikrein 5 (Catalog # 1108-SE) is measured byits ability to cleave the fluorogenic peptide substrate Boc-VPR-AMC (Catalog # ES011).
(1 Review)
(17 Publications)
Species: Hu
Applications: EnzAct
Kallikrein 7
Antibody [Unconjugate
AF2624
Western blot shows lysates of human skin tissue and mouse skin tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Kallikrein 7 at approximately 27-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Kallikrein 7 was detected in immersion fixed paraffin-embedded sections of human skin using 1.7 µg/mL Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IP, WB
Kallikrein
8/Neuropsin [Unconjug
2025-SE
Kallikrein 8/Neuropsin [Unconjugated]
(5 Publications)
Species: Hu
Applications: EnzAct
Kallikrein 14
[Unconjugated]
2626-SE
Recombinant Human Kallikrein 14 (Catalog # 2626‑SE) ismeasured by its ability to cleave the fluorogenic peptide substrate Boc-VPR-AMC (Catalog # ES011).
(1 Review)
(6 Publications)
Species: Hu
Applications: EnzAct
Kallikrein 11
Antibody [Unconjugate
AF1595
Kallikrein 11 was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Kallikrein 11 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1595) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, IP, WB
Hexokinase Type
III Antibody
NBP2-38799
Western Blot: Hexokinase Type III Antibody [NBP2-38799] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Hexokinase Type III Antibody [NBP2-38799] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Kallikrein 13
Antibody
AF2625
Kallikrein 13 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 15 µg/mL Goat Anti-Human Kallikrein 13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2625) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: IHC, IP, Neut, WB
HOOK3 Antibody -
BSA Free
NBP2-81990
Western Blot: HOOK3 Antibody [NBP2-81990] - Analysis of HOOK3 in mouse brain tissue lysate with HOOK3 antibody at 1 ug/ml.
Immunohistochemistry: HOOK3 Antibody [NBP2-81990] - Analysis of HOOK3 in mouse brain tissue with HOOK3 antibody at 10 ug/ml.
Immunocytochemistry/Immunofluorescence: HOOK3 Antibody [NBP2-81990] - Analysis of HOOK3 in mouse brain tissue with HOOK3 antibody at 20 ug/ml. Red: HOOK3 antibody [NBP2-81990]. Blue: DAPI staining
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Plasma
Kallikrein/KLKB1 Anti ...
AF2498
Plasma Kallikrein/KLKB1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IP, WB
Claudin-3 Antibody
(385021) [Unconjugate ...
MAB4620
Claudin‑3 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
Claudin‑3 was detected in immersion fixed paraffin-embedded sections of human colon array using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
Kallikrein 10
Antibody
H00005655-B01P
Kallikrein 10 Antibody
Species: Hu
Applications: WB

Publications for Kallikrein 10 Antibody (H00005655-B01P) (0)

There are no publications for Kallikrein 10 Antibody (H00005655-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 10 Antibody (H00005655-B01P) (0)

There are no reviews for Kallikrein 10 Antibody (H00005655-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 10 Antibody (H00005655-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 10 Products

Bioinformatics Tool for Kallikrein 10 Antibody (H00005655-B01P)

Discover related pathways, diseases and genes to Kallikrein 10 Antibody (H00005655-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 10 Antibody (H00005655-B01P)

Discover more about diseases related to Kallikrein 10 Antibody (H00005655-B01P).
 

Pathways for Kallikrein 10 Antibody (H00005655-B01P)

View related products by pathway.

PTMs for Kallikrein 10 Antibody (H00005655-B01P)

Learn more about PTMs related to Kallikrein 10 Antibody (H00005655-B01P).
 

Research Areas for Kallikrein 10 Antibody (H00005655-B01P)

Find related products by research area.

Blogs on Kallikrein 10

There are no specific blogs for Kallikrein 10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 10 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KLK10
Entrez
Uniprot