Kallikrein 10 Antibody - Azide and BSA Free

Western Blot: Kallikrein 10 Antibody [H00005655-B01P] - Analysis of KLK10 expression in transfected 293T cell line by KLK10 polyclonal antibody. Lane 1: KLK10 transfected lysate(30.36 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Kallikrein 10 Antibody [H00005655-B01P] - Immunofluorescence of purified MaxPab antibody to KLK10 on HeLa cell. [antibody concentration 10 ug/ml]

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kallikrein 10 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: KLK10 (AAH02710.1, 1 a.a. - 276 a.a.) full-length human protein. MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
• Specificity: KLK10 - kallikrein-related peptidase 10,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KLK10
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kallikrein 10 Antibody - Azide and BSA Free

• breast normal epithelial cell associated serine protease
• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.74
• Kallikrein 10
• kallikrein-related peptidase 10
• KLK10
• NES1
• NES1kallikrein-10
• Normal epithelial cell-specific 1
• Protease serine-like 1
• PRSSL1protease, serine-like, 1

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK10
• Entrez:
  • 5655(Human)
• Uniprot:
  • AAH02710.1(Human)