K0100 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: K0100 Antibody [NBP1-89999] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: K0100 Antibody [NBP1-89999] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

K0100 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0100
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
K0100 Protein (NBP1-89999PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for K0100 Antibody

  • Antigen MLAA-22
  • BCOX
  • BCOX1
  • Breast cancer-overexpressed gene 1 protein
  • cancer/testis antigen 101
  • CT101
  • DKFZp686M0843
  • hypothetical protein LOC9703
  • KIAA0100
  • MGC111488
  • MGC134981
  • U937-associated antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-06984
Species: Hu
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-38172
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-89999
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for K0100 Antibody (NBP1-89999) (0)

There are no publications for K0100 Antibody (NBP1-89999).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for K0100 Antibody (NBP1-89999) (0)

There are no reviews for K0100 Antibody (NBP1-89999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for K0100 Antibody (NBP1-89999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional K0100 Products

K0100 NBP1-89999

Bioinformatics Tool for K0100 Antibody (NBP1-89999)

Discover related pathways, diseases and genes to K0100 Antibody (NBP1-89999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for K0100 Antibody (NBP1-89999)

Discover more about diseases related to K0100 Antibody (NBP1-89999).

Blogs on K0100

There are no specific blogs for K0100, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our K0100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0100