JWA Recombinant Protein Antigen

Images

 
There are currently no images for JWA Protein (NBP1-84273PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JWA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL6IP5.

Source: E. coli

Amino Acid Sequence: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARL6IP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84273.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JWA Recombinant Protein Antigen

  • ADP-ribosylation factor-like protein 6-interacting protein 5
  • ADP-ribosylation-like factor 6 interacting protein 5
  • Aip-5
  • ARL-6-interacting protein 5
  • Cytoskeleton-related vitamin A-responsive protein
  • Dermal papilla-derived protein 11
  • DERP11addicsin
  • Glutamate transporter EAAC1-interacting protein
  • glutamate transporter EEAC1-associated protein
  • GTRAP3-18aip-5
  • hp22
  • HSPC127
  • JM5
  • jmx
  • JWAcytoskeleton related vitamin A responsive protein
  • PRA1 domain family 3
  • PRA1 family protein 3
  • PRA2
  • PRAF3dermal papilla derived protein 11
  • Prenylated Rab acceptor protein 2
  • Protein JWa
  • putative MAPK activating protein PM27
  • Putative MAPK-activating protein PM27

Background

The function of this protein is unknown but a similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59319
Species: Hu, Rt
Applications: ICC/IF, IP, WB
NBP1-87886
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP1-80883
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-89867
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-97475
Species: Ma, Hu, Mu, Pm, Rb, Rt
Applications: ELISA, GS, IP, WB
NBP1-91681
Species: Hu
Applications: IHC,  IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, In vivo, ISH, WB
NBP1-84273PEP
Species: Hu
Applications: AC

Publications for JWA Protein (NBP1-84273PEP) (0)

There are no publications for JWA Protein (NBP1-84273PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JWA Protein (NBP1-84273PEP) (0)

There are no reviews for JWA Protein (NBP1-84273PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JWA Protein (NBP1-84273PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JWA Products

Array NBP1-84273PEP

Research Areas for JWA Protein (NBP1-84273PEP)

Find related products by research area.

Blogs on JWA

There are no specific blogs for JWA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JWA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP5