JWA Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

JWA Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL6IP5.
  
  

  Source: E. coli

  Amino Acid Sequence: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ARL6IP5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84273.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JWA Recombinant Protein Antigen

• ADP-ribosylation factor-like protein 6-interacting protein 5
• ADP-ribosylation-like factor 6 interacting protein 5
• Aip-5
• ARL-6-interacting protein 5
• Cytoskeleton-related vitamin A-responsive protein
• Dermal papilla-derived protein 11
• DERP11addicsin
• Glutamate transporter EAAC1-interacting protein
• glutamate transporter EEAC1-associated protein
• GTRAP3-18aip-5
• hp22
• HSPC127
• JM5
• jmx
• JWAcytoskeleton related vitamin A responsive protein
• PRA1 domain family 3
• PRA1 family protein 3
• PRA2
• PRAF3dermal papilla derived protein 11
• Prenylated Rab acceptor protein 2
• Protein JWa
• putative MAPK activating protein PM27
• Putative MAPK-activating protein PM27

Background

The function of this protein is unknown but a similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ARL6IP5