JIK Antibody

Images

 
Orthogonal Strategies: Western Blot: JIK Antibody [NBP1-84988] - Analysis in human cell lines SK-MEL-30 and U2OS using Anti-TAOK3 antibody. Corresponding TAOK3 RNA-seq data are presented for the same cell lines. ...read more
Immunohistochemistry-Paraffin: JIK Antibody [NBP1-84988] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.
Western Blot: JIK Antibody [NBP1-84988] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

JIK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQSSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYRNR
Specificity
Specificity of human JIK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAOK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
JIK Lysate (NBP2-65039)
Control Peptide
JIK Protein (NBP1-84988PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for JIK Antibody

  • CTCL-associated antigen HD-CL-09
  • Cutaneous T-cell lymphoma-associated antigen HD-CL-09
  • Dendritic cell-derived protein kinase
  • DPKJNK/SAPK-inhibitory kinase
  • EC 2.7.11
  • FLJ31808
  • hKFC-A
  • JIKEC 2.7.11.1
  • Jun kinase-inhibitory kinase
  • KDS
  • Kinase from chicken homolog A
  • MAP3K18DKFZp666H245
  • serine/threonine-protein kinase TAO3
  • STE20-like kinase
  • TAO kinase 3
  • Thousand and one amino acid protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65560
Species: Hu
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84988
Species: Hu
Applications: WB, IHC, IHC-P

Publications for JIK Antibody (NBP1-84988) (0)

There are no publications for JIK Antibody (NBP1-84988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JIK Antibody (NBP1-84988) (0)

There are no reviews for JIK Antibody (NBP1-84988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JIK Antibody (NBP1-84988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for JIK Antibody (NBP1-84988)

Discover related pathways, diseases and genes to JIK Antibody (NBP1-84988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JIK Antibody (NBP1-84988)

Discover more about diseases related to JIK Antibody (NBP1-84988).
 

Pathways for JIK Antibody (NBP1-84988)

View related products by pathway.

PTMs for JIK Antibody (NBP1-84988)

Learn more about PTMs related to JIK Antibody (NBP1-84988).
 

Research Areas for JIK Antibody (NBP1-84988)

Find related products by research area.

Blogs on JIK

There are no specific blogs for JIK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JIK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAOK3