JAZF1 Antibody - BSA Free

Immunohistochemistry: JAZF1 Antibody [NBP3-10530] - Immunohistochemical analysis of human testis lysate tissue at an antibody concentration of 5.0ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

JAZF1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JAZF1 (NP_778231). Peptide sequence KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAZF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for JAZF1 Antibody - BSA Free

• JAZF zinc finger 1
• juxtaposed with another zinc finger gene 1
• juxtaposed with another zinc finger protein 1
• TAK1-interacting protein 27
• TIP27ZNF802DKFZp761K2222
• Zinc finger protein 802

Background

The JAZF1 gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor.Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively splicedvariants which encode diff

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAZF1