JAZF1 Antibody - Azide and BSA Free

Western Blot: JAZF1 Antibody [H00221895-B01P] - Analysis of JAZF1 expression in transfected 293T cell line by JAZF1 polyclonal antibody. Lane 1: JAZF1 transfected lysate(26.73 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

JAZF1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse JAZF1 Antibody - Azide and BSA Free (H00221895-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: JAZF1 (AAH42441.1, 1 a.a. - 243 a.a.) full-length human protein. MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
• Specificity: JAZF1 - juxtaposed with another zinc finger gene 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: JAZF1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for JAZF1 Antibody - Azide and BSA Free

• JAZF zinc finger 1
• juxtaposed with another zinc finger gene 1
• juxtaposed with another zinc finger protein 1
• TAK1-interacting protein 27
• TIP27ZNF802DKFZp761K2222
• Zinc finger protein 802

Background

This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAZF1
• Entrez:
  • 221895(Human)
• Uniprot:
  • AAH42441.1(Human)