IZUMO1 Antibody

Images

 
Western Blot: IZUMO1 Antibody [NBP1-69692] - This Anti-IZUMO1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IZUMO1 Antibody Summary

Immunogen
Synthetic peptides corresponding to IZUMO1(izumo sperm-egg fusion 1) The peptide sequence was selected from the C terminal of IZUMO1. Peptide sequence SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IZUMO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IZUMO1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IZUMO1 Antibody

  • FLJ61440
  • izumo sperm-egg fusion 1
  • izumo sperm-egg fusion protein 1
  • IZUMO
  • IZUMO1
  • MGC34799
  • OBF
  • Oocyte binding/fusion factor
  • Sperm-specific protein izumo

Background

The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-37395
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00083983-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
AF6146
Species: Hu
Applications: ICC
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IZUMO1 Antibody (NBP1-69692) (0)

There are no publications for IZUMO1 Antibody (NBP1-69692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IZUMO1 Antibody (NBP1-69692) (0)

There are no reviews for IZUMO1 Antibody (NBP1-69692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IZUMO1 Antibody (NBP1-69692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IZUMO1 Products

Bioinformatics Tool for IZUMO1 Antibody (NBP1-69692)

Discover related pathways, diseases and genes to IZUMO1 Antibody (NBP1-69692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IZUMO1 Antibody (NBP1-69692)

Discover more about diseases related to IZUMO1 Antibody (NBP1-69692).
 

Pathways for IZUMO1 Antibody (NBP1-69692)

View related products by pathway.

PTMs for IZUMO1 Antibody (NBP1-69692)

Learn more about PTMs related to IZUMO1 Antibody (NBP1-69692).

Blogs on IZUMO1

There are no specific blogs for IZUMO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IZUMO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IZUMO1
Entrez
Uniprot