ITPA Recombinant Protein Antigen

Images

 
There are currently no images for ITPA Recombinant Protein Antigen (NBP3-17266PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ITPA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITPA

Source: E. coli

Amino Acid Sequence: GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17266.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ITPA Recombinant Protein Antigen

  • C20orf37
  • dJ794I6.3
  • EC 3.6.1
  • EC 3.6.1.19
  • HLC14-06-P
  • inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
  • Inosine triphosphatase
  • inosine triphosphatase-A
  • inosine triphosphate pyrophosphatase
  • inosine triphosphate pyrophosphohydrolase
  • ITPase
  • My049 protein
  • nucleoside triphosphate diphosphatase
  • Putative oncogene protein hlc14-06-p

Background

ITPA is encoded by this gene hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. The encoded protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency. Two transcript variants encoding two different isoforms have been found for this gene. Also, at least two other transcript variants have been identified which are probably regulatory rather than protein-coding. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-02356
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NB100-87003
Species: Hu
Applications: IP, WB
NBP3-46642
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7049
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP3-17266PEP
Species: Hu
Applications: AC

Publications for ITPA Recombinant Protein Antigen (NBP3-17266PEP) (0)

There are no publications for ITPA Recombinant Protein Antigen (NBP3-17266PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITPA Recombinant Protein Antigen (NBP3-17266PEP) (0)

There are no reviews for ITPA Recombinant Protein Antigen (NBP3-17266PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ITPA Recombinant Protein Antigen (NBP3-17266PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ITPA Products

Research Areas for ITPA Recombinant Protein Antigen (NBP3-17266PEP)

Find related products by research area.

Blogs on ITPA

There are no specific blogs for ITPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ITPA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPA