ITCH/AIP4 Recombinant Protein Antigen

Images

 
There are currently no images for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ITCH/AIP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITCH.

Source: E. coli

Amino Acid Sequence: LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITCH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89180.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ITCH/AIP4 Recombinant Protein Antigen

  • AIF4
  • AIP4
  • AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
  • atrophin-1 interacting protein 4
  • Atrophin-1-interacting protein 4
  • dJ468O1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • ITCH
  • itchy (mouse homolog) E3 ubiquitin protein ligase
  • itchy E3 ubiquitin protein ligase homolog (mouse)
  • itchy homolog E3 ubiquitin protein ligase
  • NAPP1
  • NAPP1E3 ubiquitin-protein ligase Itchy homolog
  • NFE2-associated polypeptide 1
  • ubiquitin protein ligase ITCH

Background

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
DY413
Species: Mu
Applications: ELISA
MAB6218
Species: Hu, Mu, Rt
Applications: WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00011059-M01
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89180PEP
Species: Hu
Applications: AC

Publications for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP) (0)

There are no publications for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP) (0)

There are no reviews for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ITCH/AIP4 Products

Research Areas for ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP)

Find related products by research area.

Blogs on ITCH/AIP4

There are no specific blogs for ITCH/AIP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ITCH/AIP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITCH