IST1 Antibody

Images

 
Western Blot: IST1 Antibody [NBP1-87676] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IST1 Antibody [NBP1-87676] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IST1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPGVETDLIDVGFTDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IST1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
IST1 Protein (NBP1-87676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IST1 Antibody

  • IST1 homolog
  • increased sodium tolerance 1 homolog (yeast)
  • OLC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP2-14436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-47203
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82828
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
AF7735
Species: Hu
Applications: WB
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87676
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for IST1 Antibody (NBP1-87676) (0)

There are no publications for IST1 Antibody (NBP1-87676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IST1 Antibody (NBP1-87676) (0)

There are no reviews for IST1 Antibody (NBP1-87676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IST1 Antibody (NBP1-87676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IST1 Products

IST1 NBP1-87676

Bioinformatics Tool for IST1 Antibody (NBP1-87676)

Discover related pathways, diseases and genes to IST1 Antibody (NBP1-87676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IST1 Antibody (NBP1-87676)

Discover more about diseases related to IST1 Antibody (NBP1-87676).
 

Pathways for IST1 Antibody (NBP1-87676)

View related products by pathway.

PTMs for IST1 Antibody (NBP1-87676)

Learn more about PTMs related to IST1 Antibody (NBP1-87676).

Blogs on IST1

There are no specific blogs for IST1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IST1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IST1
Entrez
Uniprot