MITD1 Antibody

Images

 
Western Blot: MITD1 Antibody [NBP1-82828] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-339
Immunocytochemistry/ Immunofluorescence: MITD1 Antibody [NBP1-82828] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: MITD1 Antibody [NBP1-82828] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MITD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MITD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MITD1 Protein (NBP1-82828PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MITD1 Antibody

  • LOC129531
  • MIT domain-containing protein 1
  • MIT, microtubule interacting and transport, domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
H00005119-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7735
Species: Hu
Applications: WB
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-82828
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MITD1 Antibody (NBP1-82828) (0)

There are no publications for MITD1 Antibody (NBP1-82828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MITD1 Antibody (NBP1-82828) (0)

There are no reviews for MITD1 Antibody (NBP1-82828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MITD1 Antibody (NBP1-82828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MITD1 Products

Bioinformatics Tool for MITD1 Antibody (NBP1-82828)

Discover related pathways, diseases and genes to MITD1 Antibody (NBP1-82828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MITD1 Antibody (NBP1-82828)

Discover more about diseases related to MITD1 Antibody (NBP1-82828).
 

Pathways for MITD1 Antibody (NBP1-82828)

View related products by pathway.

Blogs on MITD1

There are no specific blogs for MITD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MITD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MITD1