Isoleucyl tRNA synthetase Antibody (3D3) - Azide and BSA Free

Western Blot: Isoleucyl tRNA synthetase Antibody (3D3) [H00003376-M03] - Analysis of IARS expression in transfected 293T cell line by IARS monoclonal antibody (M03), clone 3D3. Lane 1: IARS transfected lysatE (120.6 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: Isoleucyl tRNA synthetase Antibody (3D3) [H00003376-M03] - Detection limit for recombinant GST tagged IARS is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Isoleucyl tRNA synthetase Antibody (3D3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: IARS (NP_038203.1, 1172 a.a. ~ 1262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
• Specificity: IARS - isoleucine-tRNA synthetase (3D3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IARS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Isoleucyl tRNA synthetase Antibody (3D3) - Azide and BSA Free

• EC 6.1.1
• EC 6.1.1.5
• FLJ20736
• IARS1
• ILERS
• ILRS
• IRS
• isoleucine tRNA ligase 1, cytoplasmic
• Isoleucine--tRNA ligase
• isoleucyl-tRNA synthetase
• isoleucyl-tRNA synthetase, cytoplasmic
• PRO0785

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IARS1
• Entrez:
  • 3376(Human)
• Uniprot:
  • NP_038203(Human)