ISG15/UCRP Antibody

Images

 
Western Blot: ISG15/UCRP Antibody [NBP1-89809] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: ISG15/UCRP Antibody [NBP1-89809] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISG15/UCRP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISG15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ISG15/UCRP Protein (NBP1-89809PEP)
Publications
Read Publications using NBP1-89809.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24025770)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISG15/UCRP Antibody

  • G1P2
  • G1P2interferon-induced 17-kDa/15-kDa protein
  • IFI15
  • IFI15hUCRP
  • interferon, alpha-inducible protein (clone IFI-15K)
  • Interferon-induced 15 kDa protein
  • Interferon-induced 17 kDa protein
  • interferon-stimulated protein, 15 kDa
  • IP17
  • ISG15 ubiquitin-like modifier
  • ISG15
  • Ubiquitin cross-reactive protein
  • ubiquitin-like protein ISG15
  • UCRP
  • UCRPIP17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
A-306
Species: Hu
Applications: WB, IHC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92556
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89809
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ISG15/UCRP Antibody (NBP1-89809)(2)

Reviews for ISG15/UCRP Antibody (NBP1-89809) (0)

There are no reviews for ISG15/UCRP Antibody (NBP1-89809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ISG15/UCRP Antibody (NBP1-89809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ISG15/UCRP Products

Bioinformatics Tool for ISG15/UCRP Antibody (NBP1-89809)

Discover related pathways, diseases and genes to ISG15/UCRP Antibody (NBP1-89809). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISG15/UCRP Antibody (NBP1-89809)

Discover more about diseases related to ISG15/UCRP Antibody (NBP1-89809).
 

Pathways for ISG15/UCRP Antibody (NBP1-89809)

View related products by pathway.

PTMs for ISG15/UCRP Antibody (NBP1-89809)

Learn more about PTMs related to ISG15/UCRP Antibody (NBP1-89809).
 

Research Areas for ISG15/UCRP Antibody (NBP1-89809)

Find related products by research area.

Blogs on ISG15/UCRP

There are no specific blogs for ISG15/UCRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISG15/UCRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISG15
Entrez